• Featured Product
  • KD/KO Validated

Biotin-conjugated GLAST/EAAT1 Polyclonal antibody

GLAST/EAAT1 Polyclonal Antibody for IHC
Cat No. Biotin-20785

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC

EAAT1, GLAST, GLAST-1, SLC1A3, Sodium-dependent glutamate/aspartate transporter 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  Biotin
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-20785 targets GLAST/EAAT1 in IHC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14177

Product name: Recombinant human SLC1A3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 471-542 aa of BC037310

Sequence: VDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM

Predict reactive species
Full Name solute carrier family 1 (glial high affinity glutamate transporter), member 3
Calculated Molecular Weight 542 aa, 60 kDa
Observed Molecular Weight 50-55 kDa, 90-100 kDa
GenBank Accession NumberBC037310
Gene Symbol GLAST
Gene ID (NCBI) 6507
Conjugate Biotin
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP43003
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SLC1A3, also known as EAAT-1 or GLAST, is a membrane-bound protein localized in glial cells and pre-synaptic glutamatergic nerve endings. It transports the excitatory neurotransmitters L-glutamate and D-aspartate, which is essential for terminating the postsynaptic acction of glutamate. Recently, a correlation between expression/function of glial EAAT-1 and tumor proliferation has been reported. The exceptionally rare expression of EAAT-1 in non-neoplastic choroid plexus (CP) compared to choroid plexus tumors (CPT) may distinguishes neoplastic from normal CP. There are a number of splicing variants of SLC1A3, like GLAST1a and GLAST1b, exist due to the exon skipping. It also undergo glycosylation. Variety of bands can be observed in the western blotting assay: 50-55 kDa represents the unglycosylated GLAST1a or GLAST1b, 65-70 kDa correspond to the glycosylated proteins, larger proteins between 90-130 kDa may be the multimers of SLC1A3. (11086157, 17471058, 12546822)

Loading...
||
New chat Able
正在加载,请稍候...