GLCE Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GLCE Polyclonal antibody (33606-1-AP)

• 

  WB analysis using 33606-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33606-1-AP (GLCE antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 33606-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33606-1-AP (GLCE antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

GLCE Polyclonal Antibody for WB, ELISA

Cat No. 33606-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

D-glucuronyl C5-epimerase, EC:5.1.3.17, Heparan sulfate C5-epimerase, Heparin/heparan sulfate:glucuronic acid C5-epimerase, Heparosan-N-sulfate-glucuronate 5-epimerase

---

Tested Applications

• Positive WB detected in: rat liver tissue, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33606-1-AP targets GLCE in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35424

  Product name: Recombinant human GLCE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-200 aa of BC160046

  Sequence: NKCSSDKAIQFPRRSSSGFRVDGFEKRAAASESNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGRREGNEVFLPFTWVEKYFDVYGKVVQYDGYDRFEFSHSYSKVYAQRAPYHPDGVFMSFEGYNVEVRDRVKCISGVEGVPLS

• Full Name: glucuronic acid epimerase
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC160046
• Gene Symbol: GLCE
• Gene ID (NCBI): 26035
• RRID: AB_3743028
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O94923
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GLCE encodes the C5-epimerase responsible for converting glucuronic acid to iduronic acid during heparan sulfate biosynthesis. Localized in the Golgi apparatus, it indirectly regulates growth factor signaling, angiogenesis, and cell-cell interactions through structural diversification of glycosaminoglycan chains. Dysregulation of GLCE has been associated with cancer progression and developmental abnormalities, highlighting its role at the interface of glycobiology and disease. (PMID: 24499487)