GLG1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GLG1 Polyclonal antibody (34250-1-AP)

• 

  WB analysis using 34250-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34250-1-AP (GLG1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 34250-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 34250-1-AP (GLG1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 34250-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 34250-1-AP (GLG1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of HepG2 using 34250-1-AP

  1x10^6 HepG2 cells were intracellularly stained with 0.5 ug GLG1 Polyclonal antibody (34250-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.5 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019).

GLG1 Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 34250-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

CFR 1, CFR1, E selectin ligand 1, ESL 1, ESL1

---

Tested Applications

• Positive WB detected in: HepG2 cells, L02 cells, SCaBER cells, SiHa cells, mouse colon tissue, rat colon tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.5 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34250-1-AP targets GLG1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag41864

  Product name: Recombinant human GLG1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 997-1146 aa of BC060822

  Sequence: LDYRLDPQLQLHCSDEISSLCAEEAAAQEQTGQVEECLKVNLLKIKTELCKKEVLNMLKESKADIFVDPVLHTACALDIKHHCAAITPGRGRQMSCLMEALEDKRVRLQPECKKRLNDRIEMWSYAAKVAPADGFSDLAMQVMTSPSKNY

• Full Name: golgi apparatus protein 1
• Calculated Molecular Weight: 135 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC060822
• Gene Symbol: GLG1
• Gene ID (NCBI): 2734
• RRID: AB_3743180
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q92896
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Golgi apparatus protein 1 (GLG1) is also named CFR1, E-selectin ligand 1 (ESL-1) and MG160. GLG1 is a 150-160 kDa membrane sialoglycoprotein, originally isolated from the Golgi apparatus of rat neurons. Two homologs, the chicken cysteine-rich fibroblast growth factor receptor (CFR) and ESL-1, were identified in embryonic chick and murine myeloid cells, respectively (PMID: 35543162). GLG1 was originally identified as an FGF2 receptor, found in the Golgi complex (PMID:7531823). GLG1, a non-tyrosine kinase FGF receptor, is also regulated by RNA splicing (PMID: 7768993). GLG1 was found due to its significant upregulation in GC and correlation with advanced stages and lymph node metastases (PMID: 41287415).