Tested Applications
| Positive WB detected in | A549 cells, C6 cells, HEK-293 cells, human testis tissue, 4T1 cells, mouse brain tissue, NCI-H1299 cells, PC-3 cells, MCF-7 cells, MDA-MB-231 cells, pig brain tissue, rat brain tissue, BxPC-3 cells, U-251 cells, mouse liver tissue, rat liver tissue |
| Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66905-1-Ig targets GLI1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27832 Product name: Recombinant human GLI1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 470-659 aa of BC013000 Sequence: NAGGSTEDLSSLDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS Predict reactive species |
| Full Name | GLI family zinc finger 1 |
| Calculated Molecular Weight | 1106 aa, 118 kDa |
| Observed Molecular Weight | 150 kDa |
| GenBank Accession Number | BC013000 |
| Gene Symbol | GLI1 |
| Gene ID (NCBI) | 2735 |
| RRID | AB_2882232 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P08151 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GLI1, also known as Glioma-associated oncogene, is a 1106 amino acid protein, which belongs to the GLI C2H2-type zinc-finger protein family. GLI1 is detected in testis and Also expressed in the brain with highest expression in the cerebellum, optic nerve and olfactory tract. GLI1 is tethered in the cytoplasm by binding to SUFU (PubMed:10806483). GLI1 is activated and translocated to the nucleus promoted by interaction with STK36 (PubMed:10806483). Phosphorylation of GLI1 by ULK3 may promote nuclear localization (PubMed:19878745). GLI1 as a transcriptional activator may regulate the transcription of specific genes during normal development (PubMed:19706761). GLI1 plays a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract and Mediates SHH signaling (PubMed:19706761). GLI1 plays a role in cell proliferation and differentiation via its role in SHH signaling.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GLI1 antibody 66905-1-Ig | Download protocol |
| WB protocol for GLI1 antibody 66905-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
66905-1-Ig is a GLI1 antibody with 125 total citations. Publications appear in high-impact journals including Nature Communications, Cell Metabolism, Cell Host & Microbe, PNAS, EMBO Journal, Cell Reports, Science Advances, and Oncogene. Research fields span Hedgehog/GLI1 signaling, oncology (colorectal, breast, gastric, liver, lung, prostate, glioma, melanoma), stem cell biology, fibrosis, developmental biology, and neurology. Applications are predominantly Western blot, with IHC, IF, and IP also represented.
| Species | Application | Title |
|---|---|---|
Mol Cancer Circular RNA circIPO11 drives self-renewal of liver cancer initiating cells via Hedgehog signaling. | ||
Cell Metab Compartmentalized branched-chain amino acid metabolism orchestrates colorectal cancer dissemination via an UMP-vimentin axis. | ||
Cell Host Microbe BCAA-producing Clostridium symbiosum promotes colorectal tumorigenesis through the modulation of host cholesterol metabolism | ||
Nat Commun TSPAN8 promotes cancer cell stemness via activation of sonic Hedgehog signaling. | ||
Gut Microbes A 4-guanidinobutanoic acid-SLC36A1 axis drives a microbiota‒host feedback loop to regulate intestinal homeostasis. | ||
Gut Microbes Gut microbiota dysbiosis promotes the development of epithelial ovarian cancer via regulating Hedgehog signaling pathway |
Reviews
What customers say
Overall, users report mixed results. One reviewer found it works well for IHC on mouse tissue at 1:1000. Another detected the expected ~140 kDa band in human PBMC lysates by Western blot at 1:1000, though with a single band. A third reviewer was less satisfied, noting the antibody recognized a slightly higher molecular weight band that did not reflect true GLI1 induction after Shh treatment, calling it misleading. One user reported good immunofluorescence results at 1:500 in mouse NIH3T3 cells, showing the expected mixed nuclear/cytosolic staining. In summary, performance is generally positive for IHC and IF, with some caution advised for Western blot specificity.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
MALLIKARJUNA (Verified Customer) (10-17-2025) | work best for IHC
|
Bárbara (Verified Customer) (07-31-2025) | We tested the GLI1 antibody (Proteintech) for Western blot in human PBMC lysates at 1:1000 dilution. The expected ~140 kDa band low, but with one band
|
Boyan (Verified Customer) (07-23-2019) | In my experiment, I used the untreated and Shh ligand-treated cell lysates, in which the protein level of Gli1 should be increased after Shh treatment.With these two samples, I could detect a significant induction of the Gli1 protein using another Gli1 antibody. But, I could not see this induction with this antibody (66905-1-lg). A tricky thing is that, comparing with the real Gli1 band shown by the other antibody, this antibody (66905-1-lg) could recognise a protein at a similar molecular weight (but a little higher than that real Gli1). I think this is misleading, because although being shown on the website, that band is not the real band of Gli1.
|
Joshua (Verified Customer) (04-28-2019) | Cells paraformaldehyde fixed and stained for GLI1 (red). Counterstained with DRAQ7 (blue). Observed mixed nuclear/cytosolic staining as expected for GLI1.
 |
