GLIPR1 Polyclonal antibody

• 

  WB analysis using 12517-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12517-1-AP (GLIPR1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

GLIPR1 Polyclonal Antibody for WB, ELISA

Cat No. 12517-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, pig

Applications

WB, ELISA

Synonyms

RTVP1, Protein RTVP-1, GLIPR1-like protein 1, GliPR 1, GLIPR

---

Tested Applications

• Positive WB detected in: A549 cells, rat kidney tissue, pig kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12517-1-AP targets GLIPR1 in WB, ELISA applications and shows reactivity with human, rat, pig samples.

• Tested Reactivity: human, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3205

  Product name: Recombinant human GLIPR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 16-240 aa of BC012510

  Sequence: SNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIV

• Full Name: GLI pathogenesis-related 1
• Calculated Molecular Weight: 266 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC012510
• Gene Symbol: GLIPR1
• Gene ID (NCBI): 11010
• RRID: AB_3669144
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48060
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GLIPR1, also known as related to testis-specific, vespid, and pathogenesis protein 1 (RTVP-1), is a membrane protein that belongs to the CAP family of cysteine-rich secretory proteins. GLIPR1 is closely associated with the development of tumors, especially GM (8,9). The high expression of GLIPR1 was found in GM cells but not in tumors or other cells of the central nervous system.