GLIPR1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GLIPR1 Polyclonal antibody, PBS Only (12517-1-PBS)

• 

  WB analysis using 12517-1-AP (same clone as 12517-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12517-1-AP (GLIPR1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12517-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 12517-1-AP (same clone as 12517-1-PBS)

  WB result of GLIPR1 antibody (12517-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-GLIPR1 transfected HeLa cells. This data was developed using the same antibody clone with 12517-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GLIPR1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12517-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, pig

Applications

WB, Indirect ELISA

Synonyms

Glioma pathogenesis-related protein 1, GLIPR, GliPR 1, GLIPR1-like protein 1, Protein RTVP-1

---

Product Information

12517-1-PBS targets GLIPR1 in WB, Indirect ELISA applications and shows reactivity with human, rat, pig samples.

• Tested Reactivity: human, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3205

  Product name: Recombinant human GLIPR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 16-240 aa of BC012510

  Sequence: SNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIV

• Full Name: GLI pathogenesis-related 1
• Calculated Molecular Weight: 266 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC012510
• Gene Symbol: GLIPR1
• Gene ID (NCBI): 11010
• RRID: AB_3669144
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48060
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GLIPR1, also known as related to testis-specific, vespid, and pathogenesis protein 1 (RTVP-1), is a membrane protein that belongs to the CAP family of cysteine-rich secretory proteins. GLIPR1 is closely associated with the development of tumors, especially GM (8,9). The high expression of GLIPR1 was found in GM cells but not in tumors or other cells of the central nervous system.