GLIPR1L1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GLIPR1L1 Polyclonal antibody, PBS Only (20828-1-PBS)

• 

  WB analysis of human testis using 20828-1-AP (same clone as 20828-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 20828-1-AP (GLIPR1L1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20828-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 20828-1-AP (same clone as 20828-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 20828-1-AP (GLIPR1L1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20828-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 20828-1-AP (same clone as 20828-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20828-1-AP (GLIPR1L1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20828-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 20828-1-AP (same clone as 20828-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20828-1-AP (GLIPR1L1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20828-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 20828-1-AP (same clone as 20828-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20828-1-AP (GLIPR1L1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20828-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 20828-1-AP (same clone as 20828-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 20828-1-AP (GLIPR1L1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20828-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 20828-1-AP (same clone as 20828-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 20828-1-AP (GLIPR1L1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20828-1-PBS in a different storage buffer formulation.

GLIPR1L1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20828-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

ALKN2972, GLIPR1 like protein 1, GLIPR1-like protein 1, PRO7434, UNQ2972/PRO7434

---

Product Information

20828-1-PBS targets GLIPR1L1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14852

  Product name: Recombinant human GLIPR1L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-233 aa of BC014603

  Sequence: SKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFLLLRIF

• Full Name: GLI pathogenesis-related 1 like 1
• Calculated Molecular Weight: 242 aa, 27 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC014603
• Gene Symbol: GLIPR1L1
• Gene ID (NCBI): 256710
• RRID: AB_10732841
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UWM5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.