GLO1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GLO1 Polyclonal antibody, PBS Only (15140-1-PBS)

• 

  WB analysis using 15140-1-AP (same clone as 15140-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15140-1-AP (GLO1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15140-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 15140-1-AP (same clone as 15140-1-PBS)

  WB result of GLO1 antibody (15140-1-AP; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GLO1 transfected HEK-293 cells. This data was developed using the same antibody clone with 15140-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 15140-1-AP (same clone as 15140-1-PBS)

  IP result of anti-GLO1 (IP:15140-1-AP, 4ug; Detection:15140-1-AP 1:1000) with HepG2 cells lysate 1000ug. This data was developed using the same antibody clone with 15140-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 15140-1-AP (same clone as 15140-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 15140-1-AP (GLO1 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15140-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human thyroid cancer using 15140-1-AP (same clone as 15140-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 15140-1-AP (GLO1 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15140-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GLO1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 15140-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

EC:4.4.1.5, ELNR1, GLOD1, Glx I, GLYI

---

Product Information

15140-1-PBS targets GLO1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7314

  Product name: Recombinant human GLO1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-184 aa of BC001741

  Sequence: MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM

• Full Name: glyoxalase I
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21-25 kDa
• GenBank Accession Number: BC001741
• Gene Symbol: GLO1
• Gene ID (NCBI): 2739
• RRID: AB_2109890
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q04760
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glo1 is known to play a role in many diseases including diabetes mellitus, Alzheimer's disease, and cancer. The molecular mass of the dimer was 46 kDa determined by gel permeation chromatography.