GLO1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68242-1-Ig (same clone as 68242-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68242-1-Ig (GLO1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68242-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 68242-1-Ig (same clone as 68242-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 68242-1-Ig (GLO1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68242-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68242-1-Ig (same clone as 68242-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68242-1-Ig (GLO1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68242-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 68242-1-Ig (same clone as 68242-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using GLO1 antibody (68242-1-Ig, Clone: 1B7A8 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68242-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 68242-1-Ig (same clone as 68242-1-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.4 ug GLO1 Monoclonal antibody (68242-1-Ig, Clone:1B7A8) and CoraLite488-conjugated Donkey Anti-Mouse IgG(H+L)( SA00013-5)(red), or 0.4 ug Mouse IgG2a Isotype Control (C1.18.4) (65208-1-Ig, Clone: C1.18.4) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 68242-1-PBS in a different storage buffer formulation.

GLO1 Monoclonal Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 68242-1-PBS

Clone No.1B7A8

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

1B7A8, EC:4.4.1.5, ELNR1, GLOD1, Glx I

---

Product Information

68242-1-PBS targets GLO1 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7314

  Product name: Recombinant human GLO1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-184 aa of BC001741

  Sequence: MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM

• Full Name: glyoxalase I
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21-25 kDa
• GenBank Accession Number: BC001741
• Gene Symbol: GLO1
• Gene ID (NCBI): 2739
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q04760
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glo1 (glyxoalase I) is a cytosolic protein expressed in all mammalian cells. Its physiological function is the detoxification of MG (methylglyoxal), which is a potent precursor of AGEs (advanced glycation end-products). Glo1 is known to play a role in many diseases including diabetes mellitus, Alzheimer's disease, and cancer.