GLRX2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GLRX2 Polyclonal antibody, PBS Only (13381-1-PBS)

• 

  WB analysis using 13381-1-AP (same clone as 13381-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13381-1-AP (GLRX2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13381-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 13381-1-AP (same clone as 13381-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using GLRX2 antibody (13381-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13381-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GLRX2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 13381-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

13381-1-PBS targets GLRX2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4218

  Product name: Recombinant human GLRX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-148 aa of BC028113

  Sequence: RSGSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ

• Full Name: glutaredoxin 2
• Calculated Molecular Weight: 164 aa, 18 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC028113
• Gene Symbol: GLRX2
• Gene ID (NCBI): 51022
• RRID: AB_10643373
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NS18
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GLRX2(Glutaredoxin-2) is also named as GRX2 and belongs to the glutaredoxin family. It facilitates the maintenance of cellular redox homeostasis upon treatment with apoptotic agents, thereby preventing cardiolipin oxidation and cytochrome C release. The GLRX2, which exists in a dynamic equilibrium of enzymatically active monomers and quiescent dimers,is a 16-kDa protein directed either to the nucleus or to the mitochondria through differential splicing of the first exon(PMID: 17121859). It has 2 isoforms produced by alternative splicing.