Tested Applications
| Positive WB detected in | HEK-293 cells |
| Positive IHC detected in | human lung cancer tissue, human skin tissue, human rectal cancer tissue, human cervical cancer tissue, human lung cancer tissue, human colon cancer tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human lung cancer tissue, human placenta tissue |
| Positive FC (Intra) detected in | Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66290-1-Ig targets GLUT1 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17108 Product name: Recombinant human SLC2A1,GLUT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 216-280 aa of BC121804 Sequence: INRNEENRAKSVLKKLRGTADVTHDLQEMKEESRQMMREKKVTILELFRSPAYRQPILIAVVLQL Predict reactive species |
| Full Name | solute carrier family 2 (facilitated glucose transporter), member 1 |
| Calculated Molecular Weight | 492 aa, 54 kDa |
| Observed Molecular Weight | 45-55 kDa |
| GenBank Accession Number | BC121804 |
| Gene Symbol | GLUT1 |
| Gene ID (NCBI) | 6513 |
| RRID | AB_2881673 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P11166 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glucose transporter 1 (GLUT1), also known as solute carrier family 2, facilitated glucose transporter member 1 (SLC2A1), is a uniporter protein responsible for the transport of glucose in many cell types and across the blood-brain barrier.
What is the molecular weight of GLUT1? Is GLUT1 post-translationally modified?
There are two forms of GLUT1 transporter that differ in their molecular weight. The 45-kDa form is found in glial cells, while the 55-kDa form is present in the endothelial cells regulating glucose transport over the blood-brain and blood-tissue barriers (PMID: 9630522). N-glycosylation of asparagine at position 42 is the only known post-translation modification of GLUT1 (PMID: 3839598).
What is the subcellular localization of GLUT1?
Glucose transporters, including GLUT1, are multiple-pass integral membrane proteins. GLUT1 is present at the plasma membrane but is also a subject of recycling between plasma membrane and endosomes.
What molecules can be transported by GLUT1?
The main substrate of GLUT1 transport is glucose, but it can also transport galactose, mannose, glucosamine, and reduced ascorbate.
What is the tissue expression pattern of GLUT1?
GLUT1 is expressed by many cell types but the highest levels are observed in erythrocytes and in the central nervous system (astrocytes). GLUT1 is responsible for glucose transfer across the blood-brain and blood-tissue barriers, including placental transport.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for GLUT1 antibody 66290-1-Ig | Download protocol |
| IF protocol for GLUT1 antibody 66290-1-Ig | Download protocol |
| IHC protocol for GLUT1 antibody 66290-1-Ig | Download protocol |
| WB protocol for GLUT1 antibody 66290-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GLUT1 Monoclonal antibody (catalog #66290-1-Ig) has 108 citations. These appear across journals including Nature Nanotechnology, Cell Metabolism, Nature Communications, Molecular Cancer, ACS Nano, Advanced Science, Molecular Cell, Brain, Cell Reports, and Journal of Biological Chemistry, among others. Research fields span cancer metabolism and glycolysis, immunotherapy, neurodegeneration (ALS, Alzheimer's, Parkinson's), stroke, diabetes, inflammation, and reproductive biology. Applications are predominantly Western blot, with IHC and IF also represented.
| Species | Application | Title |
|---|---|---|
Nat Nanotechnol Nanoparticles for inducing Gaucher disease-like damage in cancer cells
| ||
Cell Metab Acetate enables metabolic fitness and cognitive performance during sleep disruption | ||
Cell Metab Di-methylation of CD147-K234 Promotes the Progression of NSCLC by Enhancing Lactate Export. | ||
Adv Mater Manganese Galvanic Cells Intervene in Tumor Metabolism to Reinforce cGAS-STING Activation for Bidirectional Synergistic Hydrogen-Immunotherapy | ||
Clin Mol Hepatol Correspondence on Editorial regarding "UBE2S promotes glycolysis in hepatocellular carcinoma by enhancing E3 enzyme-independent polyubiquitination of VHL" |
Reviews
What customers say
Both reviewers used this antibody for Western Blot and reported only moderate performance. One user found the signal weak with a not-very-clean background at a 1:1000 dilution on HeLa cells and mouse tissues. The other noted that the recommended 1:1500–1:3000 dilution was insufficient; they had to increase the concentration to 1:500 to visualize bands in fallopian tube epithelial cells. Overall, the antibody is described as functional but underwhelming, with suboptimal signal-to-background and a need for higher-than-recommended dilution.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Hua (Verified Customer) (09-06-2023) | Works ok in WB. Signal is weak and background is not very clean.
 |
Iru (Verified Customer) (04-23-2019) | This antibody works ok-ish, even though the protocol says use 1:1500 to 1:3000, I have to use 1:500 to see the bands.
|
