GLYCTK Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GLYCTK Polyclonal antibody (12426-1-AP)

GLYCTK Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12426-1-AP Copied!

Reviews (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HBEBP4, HBEBP2, HBeAgBP4A, HBeAg-binding protein 4, GLYCTK1

• 

  WB analysis of human lung using 12426-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 12426-1-AP (GLYCTK antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 12426-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 12426-1-AP (GLYCTK antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 12426-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12426-1-AP (GLYCTK antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 12426-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using GLYCTK antibody (12426-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GLYCTK in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human lung tissue, human liver tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12426-1-AP targets GLYCTK in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3097

  Product name: Recombinant human GLYCTK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 151-457 aa of BC021896

  Sequence: KALSQLKGGGLAQAAYPAQVVSLILSDVVGDPVEVIASGPTVASSHNVQDCLHILNRYGLRAALPRSVKTVLSRADSDPHGPHTCGHVLNVIIGSNVLALAEAQRQAEALGYQAVVLSAAMQGDVKSMAQFYGLLAHVARTRLTPSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRGGRNQELALRVGAELRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDIATFLAHNDSHTFFCCLQGGAHLLHTGMTGTNVMDTHLLFLRPR

• Full Name: glycerate kinase
• Calculated Molecular Weight: 523 aa, 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC021896
• Gene Symbol: GLYCTK
• Gene ID (NCBI): 132158
• RRID: AB_2110802
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IVS8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

5.0 out of 5

3 verified customer reviews

What customers say

All three reviews rated the antibody 5 stars for Western Blot at a 1:1000 dilution. Users highlighted its high specificity and overall performance, with one reviewer simply noting it as a "great antibody." The product was tested on cancer cell lines and melanoma samples, with no reported issues across different lots. Overall, reviewers expressed strong satisfaction with the antibody's reliability and specificity in WB applications.

Automatically generated from the 3 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Casey (Verified Customer) (11-30-2025)

Great antibody

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000

Haley (Verified Customer) (11-26-2025)

High specificity

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Cancer cell lines

Diana (Verified Customer) (10-17-2025)

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: melanoma