GLYCTK Polyclonal antibody

• 

  WB analysis of human lung using 12426-1-AP

  human lung tissue were subjected to SDS PAGE followed by western blot with 12426-1-AP (GLYCTK antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 12426-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 12426-1-AP (GLYCTK antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas cancer using 12426-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12426-1-AP (GLYCTK antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of HeLa using 12426-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using GLYCTK antibody (12426-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

GLYCTK Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12426-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HBEBP4, HBEBP2, HBeAgBP4A, HBeAg-binding protein 4, GLYCTK1

---

Tested Applications

• Positive WB detected in: human lung tissue, human liver tissue
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12426-1-AP targets GLYCTK in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3097

  Product name: Recombinant human GLYCTK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 151-457 aa of BC021896

  Sequence: KALSQLKGGGLAQAAYPAQVVSLILSDVVGDPVEVIASGPTVASSHNVQDCLHILNRYGLRAALPRSVKTVLSRADSDPHGPHTCGHVLNVIIGSNVLALAEAQRQAEALGYQAVVLSAAMQGDVKSMAQFYGLLAHVARTRLTPSMAGASVEEDAQLHELAAELQIPDLQLEEALETMAWGRGPVCLLAGGEPTVQLQGSGRGGRNQELALRVGAELRRWPLGPIDVLFLSGGTDGQDGPTEAAGAWVTPELASQAAAEGLDIATFLAHNDSHTFFCCLQGGAHLLHTGMTGTNVMDTHLLFLRPR

• Full Name: glycerate kinase
• Calculated Molecular Weight: 523 aa, 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC021896
• Gene Symbol: GLYCTK
• Gene ID (NCBI): 132158
• RRID: AB_2110802
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IVS8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Diana (Verified Customer) (10-17-2025)

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: melanoma