• Featured Product
  • KD/KO Validated

GMF Beta Polyclonal antibody

GMF Beta Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 10690-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, FC (Intra), ELISA

GMFB, Glia maturation factor beta, glia maturation factor, beta, GMF, GMF-beta

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, human heart tissue, human brain tissue, PC-12 cells, mouse heart tissue, rat brain tissue, SH-SY5Y cells, U-87 MG cells
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive FC (Intra) detected inU-87 MG cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10690-1-AP targets GMF Beta in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1104

Product name: Recombinant human GMFB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-154 aa of BC005359

Sequence: MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFTNVNFCVSKVFMY

Predict reactive species
Full Name glia maturation factor, beta
Calculated Molecular Weight 17 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC005359
Gene Symbol GMFB
Gene ID (NCBI) 2764
RRIDAB_2110837
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP60983
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GMFB, Glia maturation factor beta, is a nerve growth factor implicated in nervous system development. It was reported that GMF-beta promotes the phenotypic expression of glia and neurons and inhibits the proliferation of their respective tumors in culture cells. GMF-beta protein is specific to the brain where it is expressed in glial cells (mainly astrocytes) and insome neurons. Higher levels of GMFB were found in the central nervous system, except for the spinal cord, and in thymus and colon. GMFB was positive in the cytoplasm and nuclei of all cells in whole brain.

Protocols

Product Specific Protocols
FC protocol for GMF Beta antibody 10690-1-APDownload protocol
IF protocol for GMF Beta antibody 10690-1-APDownload protocol
IHC protocol for GMF Beta antibody 10690-1-APDownload protocol
WB protocol for GMF Beta antibody 10690-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Int J Biol Macromol

SUMOylation of GMFB regulates its stability and function in retinal pigment epithelial cells under hyperglycemia

Authors - Wan Sun
mouseIHC

Development

Coronary veins determine the pattern of sympathetic innervation in the developing heart.

Authors - Nam Joseph J
humanIHC

Int J Mol Sci

Parkinson's Disease Dementia Patients: Expression of Glia Maturation Factor in the Brain

Authors - Ramasamy Thangavel
humanWB,IHC

Eur J Cancer

Identification of glia maturation factor beta as an independent prognostic predictor for serous ovarian cancer.

Authors - Li Yan Li YL
humanWB

Front Oncol

Glia Maturation Factor Beta as a Novel Biomarker and Therapeutic Target for Hepatocellular Carcinoma.

Authors - Wan Sun
humanWB,IF

Front Oncol

Glia Maturation Factor β as a Novel Independent Prognostic Biomarker and Potential Therapeutic Target of Kidney Renal Clear Cell Carcinoma.

Authors - Tong Zhu
Loading...
||
New chat

Able

正在加载,请稍候...