Use Able AI chat for product recommendations

GMF Beta Monoclonal antibody

GMF Beta Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60062-1-Ig
Clone No. 3B10A2
Publications (5)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, pig and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

glia maturation factor beta, GMF Beta, GMFB, GMF-beta

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for GMF Beta in ?

Tested Applications

Positive WB detected infetal human brain tissue, pig liver tissue
Positive IHC detected inhuman brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU-87 MG cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60062-1-Ig targets GMF Beta in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1104

Product name: Recombinant human GMFB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-154 aa of BC005359

Sequence: MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFTNVNFCVSKVFMY

Predict reactive species
Full Name glia maturation factor, beta
Calculated Molecular Weight 17 kDa
Observed Molecular Weight 17 kDa
GenBank Accession NumberBC005359
Gene Symbol GMFB
Gene ID (NCBI) 2764
RRIDAB_2110835
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP60983
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GMFB, Glia maturation factor beta, is a nerve growth factor implicated in nervous system development. It was reported that GMF-beta promotes the phenotypic expression of glia and neurons and inhibits the proliferation of their respective tumors in culture cells. GMF-beta protein is specific to the brain where it is expressed in glial cells (mainly astrocytes) and insome neurons. Higher levels of GMFB were found in the central nervous system, except for the spinal cord, and in thymus and colon.

Protocols

Product Specific Protocols
IF protocol for GMF Beta antibody 60062-1-IgDownload protocol
IHC protocol for GMF Beta antibody 60062-1-IgDownload protocol
WB protocol for GMF Beta antibody 60062-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-GMFB antibody (Cat# 60062-1-Ig) has 5 total citations across journals including Int J Biol Macromol, Transl Psychiatry, Front Oncol, J Alzheimers Dis, and PLoS One. Research fields span retinal pigment epithelial cell biology under hyperglycemia, bipolar disorder biomarkers, kidney renal clear cell carcinoma prognosis, Alzheimer's disease neuroinflammation, and mast cell-mediated inflammatory responses involving dopaminergic toxins. Applications cited include IF and IP in human (and one mouse) samples.

SpeciesApplicationTitle
humanIF

Int J Biol Macromol

SUMOylation of GMFB regulates its stability and function in retinal pigment epithelial cells under hyperglycemia

Authors - Wan Sun
humanIP

Transl Psychiatry

Bipolar disorder in youth is associated with increased levels of vitamin D-binding protein.

Authors - Brawnie Petrov
humanIF

J Alzheimers Dis

Co-Localization of Glia Maturation Factor with NLRP3 Inflammasome and Autophagosome Markers in Human Alzheimer's Disease Brain.

Authors - Mohammad Ejaz Ahmed
humanIF

Front Oncol

Glia Maturation Factor β as a Novel Independent Prognostic Biomarker and Potential Therapeutic Target of Kidney Renal Clear Cell Carcinoma.

Authors - Tong Zhu
human, mouseIF

PLoS One

Dopaminergic Toxin 1-Methyl-4-Phenylpyridinium, Proteins α-Synuclein and Glia Maturation Factor Activate Mast Cells and Release Inflammatory Mediators.

Authors - Duraisamy Kempuraj
Loading...
||
New chat

Able™

正在加载,请稍候...