GMIP Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86101-2-RR (same clone as 86101-2-PBS)

  Jurkat cell lysates were subjected to SDS PAGE followed by western blot with 86101-2-RR (GMIP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86101-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 86101-2-RR (same clone as 86101-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 86101-2-RR (GMIP antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86101-2-PBS in a different storage buffer formulation.

• 

  IF Staining of K-562 using 86101-2-RR (same clone as 86101-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using GMIP antibody (86101-2-RR, Clone: 250483G2 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 86101-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86101-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86101-2-RR against Human GMIP were performed. The affinity constant is 2.02 nM.

GMIP Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 86101-2-PBS

Clone No.250483G2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ARHGAP46, GEM interacting protein, GEM-interacting protein

---

Product Information

86101-2-PBS targets GMIP in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag23239

  Product name: Recombinant human GMIP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-91 aa of BC126436

  Sequence: MDAAEPGLPPGPEGRKRYSDIFRSLDNLEISLGNVTLEMLAGDPLLSEDPEPDKTPTATVTNEASCWSGPSPEGPVPLTGEELDLRLIRTK

• Full Name: GEM interacting protein
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC126436
• Gene Symbol: GMIP
• Gene ID (NCBI): 51291
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9P107
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GMIP (Gem-interacting protein) is a 970 amino acid protein that stimulates the GTPase activity of RhoA in vitro and in vivo. GMIP interacts with Gem through its N-terminus and has a Rho GTPase-activating protein domain at its C-terminus. The Rho family of GTP-binding proteins plays a role in the development of neuronal structure. GMIP is able to inhibit RhoA function, leading to Actin cytoskeletal reorganization in vivo.