GMPS Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GMPS Polyclonal antibody (16376-1-AP)

GMPS Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 16376-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

Glutamine amidotransferase, GMP synthetase, GMPS

• 

  WB analysis of HeLa using 16376-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16376-1-AP (GMPS antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HL-60 using 16376-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 16376-1-AP (GMPS antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 16376-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 16376-1-AP (GMPS antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 16376-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16376-1-AP (GMPS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 16376-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 16376-1-AP (GMPS antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 16376-1-AP

  IP result of anti-GMPS (IP:16376-1-AP, 4ug; Detection:16376-1-AP 1:800) with HeLa cells lysate 1080ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16376-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16376-1-AP (GMPS antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 16376-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 16376-1-AP (GMPS antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GMPS in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HL-60 cells, Jurkat cells, mouse brain tissue, mouse testis tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16376-1-AP targets GMPS in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9350

  Product name: Recombinant human GMPS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 345-693 aa of BC012178

  Sequence: VKIANEVIGEMNLKPEEVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEGKVIEPLKDFHKDEVRILGRELGLPEELVSRHPFPGPGLAIRVICAEEPYICKDFPETNNILKIVADFSASVKKPHTLLQRVKACTTEEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKDEPDWESLIFLARLIPRMCHNVNRVVYIFGPPVKEPPTDVTPTFLTTGVLSTLRQADFEAHNILRESGYAGKISQMPVILTPLHFDRDPLQKQPSCQRSVVIRTFITSDFMTGIPATPGNEIPVEVVLKMVTEIKKIPGISRIMYDLTSKPPGTTEWE

• Full Name: guanine monphosphate synthetase
• Calculated Molecular Weight: 693 aa, 77 kDa
• Observed Molecular Weight: 67 kDa
• GenBank Accession Number: BC012178
• Gene Symbol: GMPS
• Gene ID (NCBI): 8833
• RRID: AB_2232412
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49915
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

GMPS Polyclonal antibody (Cat# 16376-1-AP) has 12 total citations published in journals including Cell, Nature Immunology, Molecular Cell, Journal of Biomedical Science, Cell Reports, PLoS Biology, Aging, Cell Oncology, Journal of Pathology, Journal of Proteome Research, and Molecular Carcinogenesis. Associated research fields include purine metabolism, de novo nucleotide synthesis, mitochondrial function, and multiple cancer types such as lung, breast, cervical, esophageal, nasopharyngeal, and bladder cancers.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Cell; De novo and salvage purine synthesis pathways across tissues and tumors; Authors - Diem H Tran
mouse	WB	Nat Immunol; Purine salvage pathway protects CD8(+) T cells from metabolic stress.; Authors - Masaki Tajima
		Mol Cell; Accumulation of succinate suppresses de novo purine synthesis through succinylation-mediated control of the mitochondrial folate cycle.; Authors - Mushtaq A. Nengroo
human	WB	Mol Cell; ERK2 Phosphorylates PFAS to Mediate Posttranslational Control of De Novo Purine Synthesis.; Authors - Eunus S Ali
human	WB,IHC	J Biomed Sci; TRIM21-SERPINB5 aids GMPS repression to protect nasopharyngeal carcinoma cells from radiation-induced apoptosis.; Authors - Panpan Zhang
mouse	WB	Cell Rep; Mutant CHCHD10 causes an extensive metabolic rewiring that precedes OXPHOS dysfunction in a murine model of mitochondrial cardiomyopathy.; Authors - Nicole M Sayles