GNA14 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GNA14 Polyclonal antibody, PBS Only (13350-1-PBS)

• 

  WB analysis of mouse lung using 13350-1-AP (same clone as 13350-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13350-1-AP (GNA14 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13350-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 13350-1-AP (same clone as 13350-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13350-1-AP (GNA14 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13350-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 13350-1-AP (same clone as 13350-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 13350-1-AP (GNA14 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 13350-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 13350-1-AP (same clone as 13350-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 13350-1-AP (GNA14 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 13350-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13350-1-AP (same clone as 13350-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 13350-1-AP (GNA14 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13350-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13350-1-AP (same clone as 13350-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using GNA14 antibody (13350-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 13350-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 13350-1-AP (same clone as 13350-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using GNA14 antibody 13350-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 13350-1-PBS in a different storage buffer formulation.

GNA14 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13350-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Guanine nucleotide-binding protein subunit alpha-14, G-protein subunit alpha-14, G alpha-14

---

Product Information

13350-1-PBS targets GNA14 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3930

  Product name: Recombinant human GNA14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-355 aa of BC027886

  Sequence: MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV

• Full Name: guanine nucleotide binding protein (G protein), alpha 14
• Calculated Molecular Weight: 355 aa, 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC027886
• Gene Symbol: GNA14
• Gene ID (NCBI): 9630
• RRID: AB_2877942
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95837
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.