GNB3 Recombinant monoclonal antibody

GNB3 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83452-4-RR
Clone No.240281D1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), ELISA

240281D1, Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, L02 cells, HepG2 cells, C6 cells, mouse brain tissue, mouse cerebellum tissue, rat brain tissue
Positive FC (Intra) detected inHepG2 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83452-4-RR targets GNB3 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0127

Product name: Recombinant human GNB3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-270 aa of BC000115

Sequence: MGEMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESII

Predict reactive species
Full Name guanine nucleotide binding protein (G protein), beta polypeptide 3
Calculated Molecular Weight 37 kDa
Observed Molecular Weight 35-37 kDa
GenBank Accession NumberBC000115
Gene Symbol GNB3
Gene ID (NCBI) 2784
RRIDAB_3671089
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP16520
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Guanine nucleotide-binding proteins (g proteins) are involved as a modulator or transducer in various transmembrane signaling systems, by integrating signals between receptors and effector proteins. G proteins are composed of an alpha, a beta, and a gamma subunit. This gene encodes a 34 kd beta subunit, being expressed in all tissues. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors.

Protocols

Product Specific Protocols
FC protocol for GNB3 antibody 83452-4-RRDownload protocol
WB protocol for GNB3 antibody 83452-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...