GNG3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GNG3 Polyclonal antibody, PBS Only (26892-1-PBS)

• 

  WB analysis using 26892-1-AP (same clone as 26892-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26892-1-AP (GNG3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26892-1-PBS in a different storage buffer formulation.

GNG3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26892-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

26892-1-PBS targets GNG3 in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25341

  Product name: Recombinant human GNG3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-60 aa of BC015563

  Sequence: MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT

• Full Name: guanine nucleotide binding protein (G protein), gamma 3
• Calculated Molecular Weight: 8 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC015563
• Gene Symbol: GNG3
• Gene ID (NCBI): 2785
• RRID: AB_3085915
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P63215
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GNG3, also named as GNGT3, belongs to the G protein gamma family. G proteins are heterotrimers of alpha, beta, and gamma subunits. Gamma subunits, such as GNG3, contribute to the specificity of the hundreds of receptor signaling pathways involving G proteins. GNG3 is predominantly expressed in the brain, where its expression increases during postnatal development.