Product Information
31393-1-PBS targets GNG7 in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.
| Tested Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34754 Product name: Recombinant human GNG7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC014466 Sequence: MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL Predict reactive species |
| Full Name | guanine nucleotide binding protein (G protein), gamma 7 |
| Calculated Molecular Weight | 8 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC014466 |
| Gene Symbol | GNG7 |
| Gene ID (NCBI) | 2788 |
| RRID | AB_3669962 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | O60262 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
GNG7 belongs to the large guanine nucleotide binding protein γ family and is located on chromosome 19. Related genes of the G protein family are involved in various transmembrane signaling transduction pathways. GNG7 may be associated with transmembrane signaling pathways and involved in cell contact-induced growth arrest, thus repressing uncontrolled cell proliferation in multicellular organisms. GNG7 is a heterotrimeric G protein subunit with ubiquitous expression in various tissues but low expression in cancer. GNG7 overexpression inhibited cell growth and tumorigenicity of esophageal carcinoma cells. Also, GNG7 was confirmed as an essential autophagy-inducing agent and participated in inhibiting tumor progression through mTOR pathway (PMID: 30864685, 35281820, 36159963).
