Home
Products
Primary Antibodies
Recombinant Antibodies
GNLY/Granulysin Recombinant monoclonal antibody, PBS Only (87707-3-PBS)

Filter: AllWBIHCAffinity

WB analysis of NK-92 using 87707-3-RR (same clone as 87707-3-PBS)
NK-92 cells were subjected to SDS PAGE followed by western blot with 87707-3-RR (Granulysin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87707-3-PBS in a different storage buffer formulation.
WB analysis of Recombinant protein using 87707-3-RR (same clone as 87707-3-PBS)
Granulysin Recombinant protein Eg4482 was subjected to SDS PAGE followed by western blot with 87707-3-RR (Granulysin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87707-3-PBS in a different storage buffer formulation.
IHC staining of human tonsil using 87707-3-RR (same clone as 87707-3-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsil tissue slide using 87707-3-RR (GNLY/Granulysin antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87707-3-PBS in a different storage buffer formulation.
IHC staining of human tonsil using 87707-3-RR (same clone as 87707-3-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsil tissue slide using 87707-3-RR (GNLY/Granulysin antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87707-3-PBS in a different storage buffer formulation.
Affinity of 87707-3-RR
Biolayer interferometry (BLI) kinetic assays of 87707-3-RR against Human GNLY/Granulysin were performed. The affinity constant is 1.03 nM.

GNLY/Granulysin Recombinant monoclonal antibody, PBS Only

Name: GNLY/Granulysin Recombinant monoclonal antibody, PBS Only
Brand: Proteintech
SKU: 87707-3-PBS

GNLY/Granulysin Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 87707-3-PBS

Clone No.252602F8

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

GNLY, Granulysin, LAG2, Lymphokine LAG-2, NKG5

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

87707-3-PBS targets GNLY/Granulysin in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg3381 Product name: Recombinant human Granulysin protein Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-145 aa of NM_006433.5 Sequence: RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL Predict reactive species
Full Name	granulysin
Calculated Molecular Weight	16 kDa
Observed Molecular Weight	14-15 kDa
GenBank Accession Number	NM_006433.5
Gene Symbol	GNLY
Gene ID (NCBI)	10578
RRID	AB_3745708
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P22749-1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Granulysin is a cationic, saposin-like antimicrobial protein expressed in cytotoxic granules of human CD8+ T cells and NK cells. It exists as 9-kDa (cytolytic) and 15-kDa (secreted) isoforms, killing intracellular pathogens and tumor cells by disrupting membranes or inducing ER stress-mediated apoptosis.(PMID: 17596262;17182542)