GNLY/Granulysin Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• GNLY/Granulysin Recombinant monoclonal antibody (87707-3-RR)

• 

  WB analysis of NK-92 using 87707-3-RR

  NK-92 cells were subjected to SDS PAGE followed by western blot with 87707-3-RR (Granulysin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Recombinant protein using 87707-3-RR

  Granulysin Recombinant protein Eg4482 was subjected to SDS PAGE followed by western blot with 87707-3-RR (Granulysin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsil using 87707-3-RR

  Immunohistochemical analysis of paraffin-embedded human tonsil tissue slide using 87707-3-RR (GNLY/Granulysin antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsil using 87707-3-RR

  Immunohistochemical analysis of paraffin-embedded human tonsil tissue slide using 87707-3-RR (GNLY/Granulysin antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity of 87707-3-RR

  Biolayer interferometry (BLI) kinetic assays of 87707-3-RR against Human GNLY/Granulysin were performed. The affinity constant is 1.03 nM.

GNLY/Granulysin Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 87707-3-RR

Clone No.252602F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

GNLY, Granulysin, LAG2, Lymphokine LAG-2, NKG5

---

Tested Applications

• Positive WB detected in: NK-92 cells, Recombinant protein
• Positive IHC detected in: human tonsil tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87707-3-RR targets GNLY/Granulysin in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3381

  Product name: Recombinant human Granulysin protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 23-145 aa of NM_006433.5

  Sequence: RLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPL

• Full Name: granulysin
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 14-15 kDa
• GenBank Accession Number: NM_006433.5
• Gene Symbol: GNLY
• Gene ID (NCBI): 10578
• RRID: AB_3745708
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P22749-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Granulysin is a cationic, saposin-like antimicrobial protein expressed in cytotoxic granules of human CD8+ T cells and NK cells. It exists as 9-kDa (cytolytic) and 15-kDa (secreted) isoforms, killing intracellular pathogens and tumor cells by disrupting membranes or inducing ER stress-mediated apoptosis.(PMID: 17596262;17182542)