GNPTG Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GNPTG Polyclonal antibody, PBS Only (14074-1-PBS)

• 

  WB analysis using 14074-1-AP (same clone as 14074-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14074-1-AP (GNPTG antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14074-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14074-1-AP (same clone as 14074-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14074-1-AP (GNPTG antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14074-1-PBS in a different storage buffer formulation.

GNPTG Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14074-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

C16orf27, CAB56184, GlcNAc-1-phosphotransferase subunit gamma, GNPTAG, LP2537

---

Product Information

14074-1-PBS targets GNPTG in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5153

  Product name: Recombinant human GNPTG protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 5-304 aa of BC014592

  Sequence: LARLLLLLGLSAGGPAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDQVEQDLADELITPQGHEKLLRTLFEDAGYLKTPENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPGLRGSL

• Full Name: N-acetylglucosamine-1-phosphate transferase, gamma subunit
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa, 68~70 kDa
• GenBank Accession Number: BC014592
• Gene Symbol: GNPTG
• Gene ID (NCBI): 84572
• RRID: AB_3741852
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UJJ9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GlcNAc-phosphotransferase is a multisubunit enzyme with an α2β2γ2 arrangement that requires a detergent for solubilization. Recent cloning of cDNAs and genes encoding these subunits revealed that the α- and β-subunits are encoded by a single gene as a precursor, whereas the γ-subunit is encoded by a second gene. Sugar composition and/ or additional modifications which alter the charge of the GNPTAG oligosaccharide chains are variable in a cell type-depending manner.