GOLIM4 Polyclonal antibody

• 

  WB analysis using 31083-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31083-1-AP (GOLIM4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 31083-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 31083-1-AP (GOLIM4 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 31083-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 31083-1-AP (GOLIM4 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 31083-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GOLIM4 antibody (31083-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• 

  IF Staining of HeLa using 31083-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GOLIM4 antibody (31083-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CoraLite®594-Phalloidin (red).

GOLIM4 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 31083-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

GIMPC, GOLPH4, GPP130, P 138, P138

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

31083-1-AP targets GOLIM4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34962

  Product name: Recombinant human GOLIM4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 350-500 aa of NM_014498

  Sequence: QVGQAEHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQVEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDIVQGAEDQGIQ

• Full Name: golgi integral membrane protein 4
• Calculated Molecular Weight: 82 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: NM_014498
• Gene Symbol: GOLIM4
• Gene ID (NCBI): 27333
• RRID: AB_3669846
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O00461
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Golgi integral membrane protein 4 (GOLIM4) is a 130-kDa membrane protein that is integrated into the cis/medial Golgi apparatus, which is a kind II Golgi protein. GOLIM4 is a Golgi protein that circulates between Golgi apparatus and endosomes, and its shuttle is pH sensitive(PMID:30068697).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Clin Transl Med; PCIF1 drives oesophageal squamous cell carcinoma progression via m6Am-mediated suppression of MTF2 translation; Authors - Kang Li
human,mouse	WB,IP,IF	Proc Natl Acad Sci U S A; Monensin suppresses EMT-driven cancer cell motility by inducing Golgi pH-dependent exocytosis of GOLIM4; Authors - Xiaochao Tan ; KD Validated