GOLPH3 Monoclonal antibody, PBS Only

• 

  WB analysis using 67777-1-Ig (same clone as 67777-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67777-1-Ig (GOLPH3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67777-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67777-1-Ig (same clone as 67777-1-PBS)

  WB result of GOLPH3 antibody (67777-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GOLPH3 transfected HeLa cells. This data was developed using the same antibody clone with 67777-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67777-1-Ig (same clone as 67777-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67777-1-Ig (GOLPH3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67777-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67777-1-Ig (same clone as 67777-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67777-1-Ig (GOLPH3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67777-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67777-1-Ig (same clone as 67777-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67777-1-Ig (GOLPH3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67777-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67777-1-Ig (same clone as 67777-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67777-1-Ig (GOLPH3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67777-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67777-1-Ig (same clone as 67777-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67777-1-Ig (GOLPH3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67777-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67777-1-Ig (same clone as 67777-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67777-1-Ig (GOLPH3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67777-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67777-1-Ig (same clone as 67777-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GOLPH3 antibody (67777-1-Ig, Clone: 3H2A5 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67777-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GOLPH3 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67777-1-PBS

Clone No.3H2A5

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MIDAS, GPP34, GOPP1, GOLPH 3, Golgi phosphoprotein 3

---

Product Information

67777-1-PBS targets GOLPH3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5443

  Product name: Recombinant human GOLPH3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-298 aa of BC033725

  Sequence: MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK

• Full Name: golgi phosphoprotein 3 (coat-protein)
• Calculated Molecular Weight: 298 aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC033725
• Gene Symbol: GOLPH3
• Gene ID (NCBI): 64083
• RRID: AB_2918542
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9H4A6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GOLPH3 (also called GPP34, GMx33, MIDAS, or yeast Vps74p) is a 34-kDa Golgi-associated protein conserved from yeast to human. GOLPH3 binds to PtdIns(4)P-rich trans-Golgi membranes and MYO18A conveying a tensile force required for efficient tubule and vesicle formation (PMID: 19837035). GOLPH3 has been recently demonstrated as a novel oncoprotein amplified in various types of human malignancies, including melanoma, breast, non-small cell lung cancer, gliomas and connective tissue tumors (PMID:19553991; 23006319; 21499727; 22745132). Enhanced activation of mTOR signaling represents a molecular basis for the oncogenic activity of GOLPH3 (PMID: 19553991).