GOLT1B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GOLT1B Polyclonal antibody (31368-1-AP)

• 

  WB analysis using 31368-1-AP

  Rat stomach tissue were subjected to SDS PAGE followed by western blot with 31368-1-AP (GOLT1B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

GOLT1B Polyclonal Antibody for WB, ELISA

Cat No. 31368-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

CGI 141, GOT1, GOT1A, HDCMA39P, hGOT1a

---

Tested Applications

• Positive WB detected in: rat stomach tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31368-1-AP targets GOLT1B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34859

  Product name: Recombinant human GOLT1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 95-138 aa of BC012455

  Sequence: FLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV

• Full Name: golgi transport 1 homolog B (S. cerevisiae)
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC012455
• Gene Symbol: GOLT1B
• Gene ID (NCBI): 51026
• RRID: AB_3742420
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y3E0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Golgi transport 1B (GOLT1B) is a member of the GOT1 family, and abnormal expressions of proteins in this family are associated with GA membrane trafficking disorders and cellular malignant behaviors. The GOT1 family consists of two primary members, GOLT1A and GOLT1B. High expression of GOLT1A has been correlated with poor prognosis and resistance to endocrine therapy in breast cancer. GOLT1B is located primarily in early Golgi cisternae, the absence of which induces a substantial reduction in the endoplasmic reticulum (ER)-Golgi transport efficiency. The amplification of GOLT1B is correlated with poor prognosis in lung cancer. GOLT1B contributes to epithelial-mesenchymal transition (EMT) in colorectal cancer (CRC) by activating WNT signaling, influencing the secretion of interferon (IFN)-γ, and apoptosis of tumor-infiltrating T lymphocytes. (PMID: 38130634)