Product Information
31368-1-PBS targets GOLT1B in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34859 Product name: Recombinant human GOLT1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 95-138 aa of BC012455 Sequence: FLLFRGFFPVVVGFIRRVPVLGSLLNLPGIRSFVDKVGESNNMV Predict reactive species |
| Full Name | golgi transport 1 homolog B (S. cerevisiae) |
| Calculated Molecular Weight | 15 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC012455 |
| Gene Symbol | GOLT1B |
| Gene ID (NCBI) | 51026 |
| RRID | AB_3742420 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9Y3E0 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Golgi transport 1B (GOLT1B) is a member of the GOT1 family, and abnormal expressions of proteins in this family are associated with GA membrane trafficking disorders and cellular malignant behaviors. The GOT1 family consists of two primary members, GOLT1A and GOLT1B. High expression of GOLT1A has been correlated with poor prognosis and resistance to endocrine therapy in breast cancer. GOLT1B is located primarily in early Golgi cisternae, the absence of which induces a substantial reduction in the endoplasmic reticulum (ER)-Golgi transport efficiency. The amplification of GOLT1B is correlated with poor prognosis in lung cancer. GOLT1B contributes to epithelial-mesenchymal transition (EMT) in colorectal cancer (CRC) by activating WNT signaling, influencing the secretion of interferon (IFN)-γ, and apoptosis of tumor-infiltrating T lymphocytes. (PMID: 38130634)
