GOSR2/Membrin Monoclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 66134-1-Ig (same clone as 66134-1-PBS)

  WB result of GOSR2/Membrin antibody (66134-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GOSR2/Membrin transfected Jurkat cells. This data was developed using the same antibody clone with 66134-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66134-1-Ig (same clone as 66134-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66134-1-Ig (GOSR2/Membrin antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66134-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66134-1-Ig (same clone as 66134-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66134-1-Ig (GOSR2/Membrin antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66134-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66134-1-Ig (same clone as 66134-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66134-1-Ig (GOSR2/Membrin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66134-1-Ig (same clone as 66134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver slide using 66134-1-Ig (GOSR2/Membrin antibody at dilution of 1:50. This data was developed using the same antibody clone with 66134-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66134-1-Ig (same clone as 66134-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver slide using 66134-1-Ig (GOSR2/Membrin antibody at dilution of 1:50. This data was developed using the same antibody clone with 66134-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver cancer using 66134-1-Ig (same clone as 66134-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using GOSR2/Membrin antibody (66134-1-Ig, Clone: 7E7C7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66134-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GOSR2/Membrin Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 66134-1-PBS

Clone No.7E7C7

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

27 kDa Golgi SNARE protein, Bos1, GOSR2, GS27, Membrin

---

Product Information

66134-1-PBS targets GOSR2/Membrin in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21393

  Product name: Recombinant human GOSR2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-192 aa of BC009710

  Sequence: MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYF

• Full Name: golgi SNAP receptor complex member 2
• Calculated Molecular Weight: 212 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC009710
• Gene Symbol: Membrin
• Gene ID (NCBI): 9570
• RRID: AB_2881533
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O14653
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Golgi SNAP receptor complex member 2 (GOSR2), also known as GS27 or Membrin, is a member of the solube NSF attachment protein receptor (SNARE) family of vesicle docking proteins. GOSR2 is localized in Golgi apparatus. It is involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network.