Tested Applications
| Positive WB detected in | pig brain tissue, A431 cells, rat brain, mouse brain, chicken brain, HEK-293 cells, HepG2 cells |
| Positive IHC detected in | mouse heart tissue, rat brain tissue, rat heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:4000-1:16000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67738-1-Ig targets GOT2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig, chicken samples.
| Tested Reactivity | human, mouse, rat, pig, chicken |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6600 Product name: Recombinant human GOT2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 82-430 aa of BC000525 Sequence: KAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQATK Predict reactive species |
| Full Name | glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2) |
| Calculated Molecular Weight | 47 kDa |
| Observed Molecular Weight | 39-40 kDa |
| GenBank Accession Number | BC000525 |
| Gene Symbol | GOT2 |
| Gene ID (NCBI) | 2806 |
| RRID | AB_2918507 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P00505 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GOT2 encodes the mitochondrial glutamate oxaloacetate transaminase and plays an essential role in the intracellular NAD(H) redox balance. Upregulation of GOT2 has been reported in various cancers, including breast cancer and pancreatic cancer. GOT2 mutation leads to autosomal recessive neurometabolic disorder.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GOT2 antibody 67738-1-Ig | Download protocol |
| WB protocol for GOT2 antibody 67738-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GOT2 Monoclonal antibody (1B6C6), catalog number 67738-1-Ig, has a total of 3 citations. These appear in Cancer Biology & Medicine, Frontiers in Pharmacology, and Journal of Virology. The associated research fields span cancer metabolism (CAR-macrophage antitumor function), lipid metabolism and pharmacology (intestinal cholesterol absorption), and virology (African swine fever virus pyrimidine metabolism). Applications cited include WB and IF across human, mouse, and pig species.
| Species | Application | Title |
|---|---|---|
Cancer Biol Med Metabolic engineering of SLC38A2 reprograms glutamine utilization and enhances CAR-macrophage antitumor function in solid tumors. | ||
Front Pharmacol Potential lipid-lowering effects of preussin B on inhibition of intestinal cholesterol absorption: integrative mechanisms of action and proteomic analysis. | ||
J Virol African swine fever virus hijacks host pyrimidine metabolism to promote viral replication.
|
Reviews
What customers say
One reviewer (5/5 stars) used this mouse GOT2 antibody for Western Blot on avian skeletal muscle (pectoralis) homogenates at a 1:6000 dilution, reporting consistent and reliable performance. They loaded 6 µg of total protein per lane on 0.2 µm nitrocellulose membranes, probed with the primary antibody in 5% milk, and detected the target using an anti-mouse secondary at 1:10000 with ECL Prime, achieving optimal results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sampath Kumar (Verified Customer) (02-26-2024) | The mouse GOT2 antibody worked consistently well at 1:6000 dilution on Avian skeletal muscle (pectoralis) homogenates. 6ug of total protein per sample was blotted on 0.2um nitrocellulose and probed with GOT2 primary antibody diluted in 5% milk. Anti-mouse secondary antibody at 1:10000 along with ECL prime provided optimum results.
![]() |












