GOT2 Monoclonal antibody

GOT2 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67738-1-Ig
Clone No.1B6C6

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig, chicken

Applications

WB, IHC, ELISA

FABP 1, FABPpm, Fatty acid binding protein, FLJ40994, GOT2, KAT4, KATIV, mAspAT, mitAAT, Transaminase A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig brain tissue, A431 cells, rat brain, mouse brain, chicken brain, HEK-293 cells, HepG2 cells
Positive IHC detected inmouse heart tissue, rat brain tissue, rat heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:4000-1:16000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67738-1-Ig targets GOT2 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat, pig, chicken samples.

Tested Reactivity Human, mouse, rat, pig, chicken
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6600

Product name: Recombinant human GOT2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 82-430 aa of BC000525

Sequence: KAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQATK

Predict reactive species
Full Name glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
Calculated Molecular Weight 47 kDa
Observed Molecular Weight39-40 kDa
GenBank Accession NumberBC000525
Gene Symbol GOT2
Gene ID (NCBI) 2806
RRIDAB_2918507
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP00505
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GOT2 encodes the mitochondrial glutamate oxaloacetate transaminase and plays an essential role in the intracellular NAD(H) redox balance. Upregulation of GOT2 has been reported in various cancers, including breast cancer and pancreatic cancer. GOT2 mutation leads to autosomal recessive neurometabolic disorder.

Protocols

Product Specific Protocols
IHC protocol for GOT2 antibody 67738-1-IgDownload protocol
WB protocol for GOT2 antibody 67738-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Sampath Kumar (Verified Customer) (02-26-2024)

The mouse GOT2 antibody worked consistently well at 1:6000 dilution on Avian skeletal muscle (pectoralis) homogenates. 6ug of total protein per sample was blotted on 0.2um nitrocellulose and probed with GOT2 primary antibody diluted in 5% milk. Anti-mouse secondary antibody at 1:10000 along with ECL prime provided optimum results.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Avian skeletal muscle (Pectoralis)
GOT2 Antibody Western Blot validation (1:5000 dilution) in Avian skeletal muscle (Pectoralis) (Cat no:67738-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...