CoraLite® Plus 488-conjugated GOT2 Monoclonal antibody

GOT2 Monoclonal Antibody for FC (Intra)
Cat No. CL488-67738
Clone No.1B6C6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, chicken

Applications

FC (Intra)

1B6C6, AATM, Aspartate aminotransferase, mitochondrial, EC:2.6.1.1, FABP 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67738 targets GOT2 in FC (Intra) applications and shows reactivity with human, mouse, rat, pig, chicken samples.

Tested Reactivity human, mouse, rat, pig, chicken
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6600

Product name: Recombinant human GOT2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 82-430 aa of BC000525

Sequence: KAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQATK

Predict reactive species
Full Name glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
Calculated Molecular Weight 47 kDa
Observed Molecular Weight39-40 kDa
GenBank Accession NumberBC000525
Gene Symbol GOT2
Gene ID (NCBI) 2806
RRIDAB_2923785
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP00505
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GOT2 encodes the mitochondrial glutamate oxaloacetate transaminase and plays an essential role in the intracellular NAD(H) redox balance. Upregulation of GOT2 has been reported in various cancers, including breast cancer and pancreatic cancer. GOT2 mutation leads to autosomal recessive neurometabolic disorder.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 GOT2 antibody CL488-67738Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...