GPATCH2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GPATCH2 Polyclonal antibody (24366-1-AP)

GPATCH2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24366-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

CT110, G patch domain-containing protein 2, GPATC2, Pfa1, PPP1R30

• 

  WB analysis of mouse spleen using 24366-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 24366-1-AP (GPATCH2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 24366-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 24366-1-AP (GPATCH2 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 24366-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 24366-1-AP (GPATCH2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 24366-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 24366-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 24366-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 24366-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 24366-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 24366-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, mouse kidney tissue, mouse thymus tissue
• Positive IHC detected in: human breast cancer tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24366-1-AP targets GPATCH2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21647

  Product name: Recombinant human GPATCH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 290-376 aa of BC063474

  Sequence: KESGGACGITGVVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHGMSSKNIKKSGGTPTSMATNWTSEIPL

• Full Name: G patch domain containing 2
• Calculated Molecular Weight: 528 aa, 59 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC063474
• Gene Symbol: GPATCH2
• Gene ID (NCBI): 55105
• RRID: AB_2879508
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NW75
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Death Dis; Deletion of Gpatch2 does not alter Tnf expression in mice; Authors - Destiny Dalseno