Home
Products
Primary Antibodies
GPATCH2 Polyclonal antibody, PBS Only (24366-1-PBS)

Filter: AllWBIHC

WB analysis of mouse spleen using 24366-1-AP (same clone as 24366-1-PBS)
mouse spleen tissue were subjected to SDS PAGE followed by western blot with 24366-1-AP (GPATCH2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24366-1-PBS in a different storage buffer formulation.
WB analysis of mouse thymus using 24366-1-AP (same clone as 24366-1-PBS)
mouse thymus tissue were subjected to SDS PAGE followed by western blot with 24366-1-AP (GPATCH2 Antibody) at dilution of 1:300 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 24366-1-PBS in a different storage buffer formulation.
WB analysis of mouse kidney using 24366-1-AP (same clone as 24366-1-PBS)
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 24366-1-AP (GPATCH2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24366-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 24366-1-AP (same clone as 24366-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24366-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 24366-1-AP (same clone as 24366-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24366-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 24366-1-AP (same clone as 24366-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24366-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 24366-1-AP (same clone as 24366-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24366-1-PBS in a different storage buffer formulation.
IHC staining of human testis using 24366-1-AP (same clone as 24366-1-PBS)
Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24366-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 24366-1-AP (same clone as 24366-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24366-1-AP (GPATCH2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24366-1-PBS in a different storage buffer formulation.

GPATCH2 Polyclonal antibody, PBS Only

Name: GPATCH2 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 24366-1-PBS

GPATCH2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24366-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

CT110, G patch domain-containing protein 2, GPATC2, Pfa1, PPP1R30

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

24366-1-PBS targets GPATCH2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag21647 Product name: Recombinant human GPATCH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 290-376 aa of BC063474 Sequence: KESGGACGITGVVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHGMSSKNIKKSGGTPTSMATNWTSEIPL Predict reactive species
Full Name	G patch domain containing 2
Calculated Molecular Weight	528 aa, 59 kDa
Observed Molecular Weight	65-70 kDa
GenBank Accession Number	BC063474
Gene Symbol	GPATCH2
Gene ID (NCBI)	55105
RRID	AB_2879508
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NW75
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.