GPD1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GPD1 Polyclonal antibody (27943-1-AP)

• Featured Product
• KD/KO Validated

GPD1 Polyclonal Antibody for WB, ELISA

Cat No. 27943-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, Rat and More (2)

Applications

WB, ELISA

Synonyms

GPD C, GPD1, GPDH C

• 

  WB analysis of rat liver using 27943-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 27943-1-AP (GPD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 27943-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 27943-1-AP (GPD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GPD1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: rat liver tissue, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27943-1-AP targets GPD1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27703

  Product name: Recombinant human GPD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 40-181 aa of BC032234

  Sequence: VFEEDIGGKKLTEIINTQHENVKYLPGHKLPPNVVAVPDVVQAAEDADILIFVVPHQFIGKICDQLKGHLKANATGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVADEKFCETTIGCKDPAQGQLLKELM

• Full Name: glycerol-3-phosphate dehydrogenase 1 (soluble)
• Calculated Molecular Weight: 349 aa, 38 kDa
• Observed Molecular Weight: 32-42 kDa
• GenBank Accession Number: BC032234
• Gene Symbol: GPD1
• Gene ID (NCBI): 2819
• RRID: AB_2881016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21695
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GPD1 Polyclonal antibody (Cat# 27943-1-AP) has 2 total citations, both published in Molecular Cell (IF 16). The studies focus on cellular metabolism and cancer biology: one investigates how saturation of mitochondrial NADH shuttles drives aerobic glycolysis in proliferating cells (2022), while the other reveals that an uncoupled glycerol-3-phosphate shuttle in kidney cancer makes cytosolic GPD essential for lipid synthesis (2023). Both used the antibody for Western blot in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Saturation of the mitochondrial NADH shuttles drives aerobic glycolysis in proliferating cells; Authors - Yahui Wang
human,mouse	WB	Mol Cell; Uncoupled glycerol-3-phosphate shuttle in kidney cancer reveals that cytosolic GPD is essential to support lipid synthesis; Authors - Cong-Hui Yao ; KD Validated