GPM6B Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GPM6B Polyclonal antibody (26122-1-AP)

• 

  WB analysis using 26122-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26122-1-AP (GPM6B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of rat brain using 26122-1-AP

  IP result of anti-GPM6B (IP:26122-1-AP, 4ug; Detection:26122-1-AP 1:1000) with rat brain tissue lysate 1720 ug.

• 

  IHC staining of mouse brain using 26122-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26122-1-AP (GPM6B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 26122-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26122-1-AP (GPM6B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 26122-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using GPM6B antibody (26122-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

GPM6B Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 26122-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

glycoprotein M6B, M6B

---

Tested Applications

• Positive WB detected in: mouse brain tissue, 37°C incubated mouse brain tissue
• Positive IP detected in: rat brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26122-1-AP targets GPM6B in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23507

  Product name: Recombinant human GPM6B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-62 aa of BC047295

  Sequence: MKPAMETAAEENTEQSQERKVNSRAEMEIGRYHWMYPGSKNHQYHPVPTLGDRASPLSSPGC

• Full Name: glycoprotein M6B
• Observed Molecular Weight: 27-36 kDa
• GenBank Accession Number: BC047295
• Gene Symbol: GPM6B
• Gene ID (NCBI): 2824
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13491
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPM6B (Glycoprotein M6B) is a highly conserved, multi-pass transmembrane glycoprotein encoded by the GPM6B gene on human chromosome Xp22.2. As a member of the proteolipid protein family, it is predominantly expressed in the central nervous system (in neurons and oligodendrocytes) and is involved in key processes such as myelination, regulation of serotonin transporter (SERT) trafficking, and actin cytoskeleton maintenance. Beyond neural functions, GPM6B also promotes bone formation by regulating osteoblast mineralization and influences smooth muscle cell differentiation via the TGF‑beta‑Smad2/3 pathway. Subcellularly, it localizes to the plasma membrane and lipid rafts. Genetic variations in GPM6B have been associated with several disorders, including Pelizaeus‑Merzbacher disease, major depressive disorder, and osteoarthritis.