GPM6B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPM6B Polyclonal antibody, PBS Only (26122-1-PBS)

• 

  WB analysis using 26122-1-AP (same clone as 26122-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26122-1-AP (GPM6B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26122-1-PBS in a different storage buffer formulation.

• 

  IP experiment of rat brain using 26122-1-AP (same clone as 26122-1-PBS)

  IP result of anti-GPM6B (IP:26122-1-AP, 4ug; Detection:26122-1-AP 1:1000) with rat brain tissue lysate 1720 ug. This data was developed using the same antibody clone with 26122-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 26122-1-AP (same clone as 26122-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26122-1-AP (GPM6B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26122-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 26122-1-AP (same clone as 26122-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26122-1-AP (GPM6B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26122-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 26122-1-AP (same clone as 26122-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using GPM6B antibody (26122-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 26122-1-PBS in a different storage buffer formulation.

GPM6B Polyclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 26122-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Indirect ELISA

Synonyms

glycoprotein M6B, M6B

---

Product Information

26122-1-PBS targets GPM6B in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23507

  Product name: Recombinant human GPM6B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-62 aa of BC047295

  Sequence: MKPAMETAAEENTEQSQERKVNSRAEMEIGRYHWMYPGSKNHQYHPVPTLGDRASPLSSPGC

• Full Name: glycoprotein M6B
• Observed Molecular Weight: 27-36 kDa
• GenBank Accession Number: BC047295
• Gene Symbol: GPM6B
• Gene ID (NCBI): 2824
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13491
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GPM6B (Glycoprotein M6B) is a highly conserved, multi-pass transmembrane glycoprotein encoded by the GPM6B gene on human chromosome Xp22.2. As a member of the proteolipid protein family, it is predominantly expressed in the central nervous system (in neurons and oligodendrocytes) and is involved in key processes such as myelination, regulation of serotonin transporter (SERT) trafficking, and actin cytoskeleton maintenance. Beyond neural functions, GPM6B also promotes bone formation by regulating osteoblast mineralization and influences smooth muscle cell differentiation via the TGF‑beta‑Smad2/3 pathway. Subcellularly, it localizes to the plasma membrane and lipid rafts. Genetic variations in GPM6B have been associated with several disorders, including Pelizaeus‑Merzbacher disease, major depressive disorder, and osteoarthritis.