GPN2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPN2 Polyclonal antibody, PBS Only (33504-1-PBS)

• 

  WB analysis using 33504-1-AP (same clone as 33504-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33504-1-AP (GPN2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33504-1-PBS in a different storage buffer formulation.

GPN2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33504-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

ATPBD1B, ATP-binding domain 1 family member B, GPN-loop GTPase 2, UNQ5828/PRO19647

---

Product Information

33504-1-PBS targets GPN2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39635

  Product name: Recombinant human GPN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-310 aa of NM_018066.3

  Sequence: MAGAAPTTAFGQAVIGPPGSGKTTYCLGMSEFLRALGRRVAVVNLDPANEGLPYECAVDVGELVGLGDVMDALRLGPNGGLLYCMEYLEANLDWLRAKLDPLRGHYFLFDCPGQVELCTHHGALRSIFSQMAQWDLRLTAVHLVDSHYCTDPAKFISVLCTSLATMLHVELPHINLLSKMDLIEHYGKLAFNLDYYTEVLDLSYLLDHLASDPFFRHYRQLNEKLVQLIEDYSLVSFIPLNIQDKESIQRVLQAVDKANGYCFRAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSNQSVEQEAMQL

• Full Name: GPN-loop GTPase 2
• Calculated Molecular Weight: 35kDa，310aa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: NM_018066.3
• Gene Symbol: GPN2
• Gene ID (NCBI): 54707
• RRID: AB_3742995
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9H9Y4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Gpn2 is a highly conserved protein essential for the assembly of RNA polymerase II (RNAPII) in eukaryotic cells. Mutations in Gpn2, specifically Phe105Tyr and Leu164Pro, confer temperature sensitivity and significantly impair RNAPII assembly (PMID: 39642114).