GPNMB Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP01096-1

  Sandwich ELISA standard curve of MP01096-1, Human GPNMB Recombinant Matched Antibody Pair - PBS only. 84160-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag14124. 84160-2-PBS was HRP conjugated as the detection antibody. Range: 0.781-50 ng/mL.

• 

  Sample test of MP01096-1

  Plasma of six individual healthy human donors was measured. The GPNMB concentration of detected samples was determined to be 12.18 ng/mL with a range of 3.43-30.61 ng/mL.

• 

  Sample test of MP01096-1

  Serum of six individual healthy human donors was measured. The GPNMB concentration of detected samples was determined to be 5.69 ng/mL with a range of 3.96-8.17 ng/mL.

• 

  Cytometric bead array standard curve of MP01096-1

  Cytometric bead array standard curve of MP01096-1, GPNMB Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84160-3-PBS. Detection antibody: 84160-2-PBS. Standard: Ag14124. Range: 0.781-100 ng/mL.

GPNMB Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84160-2-PBS

Clone No.241435D10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Hematopoietic growth factor inducible neurokinin-1 type, NMB, Osteoactivin, Transmembrane glycoprotein NMB, UNQ1725/PRO9925

---

Product Information

84160-2-PBS targets GPNMB as part of a matched antibody pair:

MP01096-1: 84160-3-PBS capture and 84160-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14124

  Product name: Recombinant human GPNMB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-181 aa of BC011595

  Sequence: AKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLG

• Full Name: glycoprotein (transmembrane) nmb
• Calculated Molecular Weight: 64 kDa
• GenBank Accession Number: BC011595
• Gene Symbol: GPNMB
• Gene ID (NCBI): 10457
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14956
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.