GPR103 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPR103 Polyclonal antibody, PBS Only (25247-1-PBS)

• 

  WB analysis of mouse brain using 25247-1-AP (same clone as 25247-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25247-1-AP (GPR103 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25247-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 25247-1-AP (same clone as 25247-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25247-1-AP (GPR103 antibody at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 25247-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 25247-1-AP (same clone as 25247-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 25247-1-AP (GPR103 antibody at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 25247-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

GPR103 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25247-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

25247-1-PBS targets GPR103 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19048

  Product name: Recombinant human QRFPR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 229-356 aa of BC128133

  Sequence: EYDDVTIKMIFAIVQIIGFSNSICNPIVYAFMNENFKKNVSSAVCYCIVNKTFSPAQRHGNSGITMMRKKAKFSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSELAENSPLDSGH

• Full Name: pyroglutamylated RFamide peptide receptor
• Calculated Molecular Weight: 431 aa, 49 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC128133
• Gene Symbol: GPR103
• Gene ID (NCBI): 84109
• RRID: AB_2879987
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96P65
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.