Tested Applications
| Positive WB detected in | mouse kidney tissue, rat kidney tissue |
| Positive IHC detected in | human kidney tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24009-1-AP targets GPR108 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20887 Product name: Recombinant human GPR108 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 433-543 aa of BC007862 Sequence: SVAVNLAKLKLFRHYYVMVICYVYFTRIIAILLQVAVPFQWQWLYQLLVEGSTLAFFVLTGYKFQPTGNNPYLQLPQEDEEDVQMEQVMTDSGFREGLSKVNKTASGRELL Predict reactive species |
| Full Name | G protein-coupled receptor 108 |
| Calculated Molecular Weight | 61 kDa |
| Observed Molecular Weight | 61-70 kDa |
| GenBank Accession Number | BC007862 |
| Gene Symbol | GPR108 |
| Gene ID (NCBI) | 56927 |
| RRID | AB_2879401 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q9NPR9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPR108 is a seven-transmembrane family protein that falls in the GPCRs superfamily (PMID:30332431). GPR108 was identified as a highly conserved AAV entry factor implicated in cellular immune responses to AAV (PMID:31784416). Of note is its role in activating nuclear factor kappa-B (NF-κB) signaling, which implied the potential involvement of GPR108 in inflammation-related diseases as well as cancers through dysregulating NF-κB activity (PMID:35659621).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GPR108 antibody 24009-1-AP | Download protocol |
| WB protocol for GPR108 antibody 24009-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Virol Interplay between Furin and Sialoglycans in Modulating Adeno-Associated Viral Cell Entry | ||
Nat Chem Biol Chemoproteomics reveals microbiota-derived aromatic monoamine agonists for GPRC5A |









