GPR116 Monoclonal antibody

• 

  WB analysis using 66967-2-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66967-2-Ig (GPR116 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

GPR116 Monoclonal Antibody for WB, ELISA

Cat No. 66967-2-Ig

Clone No.1H1B2

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, ELISA

Synonyms

KIAA0758, G-protein coupled receptor 116, G protein coupled receptor 116, Adhesion G protein-coupled receptor F5, ADGRF5

---

Tested Applications

• Positive WB detected in: HUVEC cells, MDA-MB-231 cells, Calu-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66967-2-Ig targets GPR116 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5820

  Product name: Recombinant human GPR116 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 34-349 aa of BC066121

  Sequence: LSLHEHEPAGEEALRQKRAVATKSPTAEEYTVNIEISFENASFLDPIKAYLNSLSFPIHGNNTDQITDILSINVTTVCRPAGNEIWCSCETGYGWPRERCLHNLICQERDVFLPGHHCSCLKELPPNGPFCLLQEDVTLNMRVRLNVGFQEDLMNTSSALYRSYKTDLETAFRKGYGILPGFKGVTVTGFKSGSVVVTYEVKTTPPSLELIHKANEQVVQSLNQTYKMDYNSFQAVTINESNFFVTPEIIFEGDTVSLVCEKEVLSSNVSWRYEEQQLEIQNSSRFSIYTALFNNMTSVSKLTIHNITPGDAGEYV

• Full Name: G protein-coupled receptor 116
• Calculated Molecular Weight: 1346 aa, 149 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC066121
• Gene Symbol: GPR116
• Gene ID (NCBI): 221395
• RRID: AB_3670377
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IZF2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPR116 (ADGRF5, adhesion G protein-coupled receptor F5) is involved in the G protein-coupled receptor signaling pathway and cell surface receptor signaling pathway. may act upstream of or within several processes, including glomerular filtration; pharyngeal arch artery morphogenesis; and surfactant homeostasis.