GPR116 Monoclonal antibody, PBS Only

• 

  WB analysis using 66967-2-Ig (same clone as 66967-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66967-2-Ig (GPR116 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66967-2-PBS in a different storage buffer formulation.

GPR116 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66967-2-PBS

Clone No.1H1B2

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

KIAA0758, G-protein coupled receptor 116, G protein coupled receptor 116, Adhesion G protein-coupled receptor F5, ADGRF5

---

Product Information

66967-2-PBS targets GPR116 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5820

  Product name: Recombinant human GPR116 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 34-349 aa of BC066121

  Sequence: LSLHEHEPAGEEALRQKRAVATKSPTAEEYTVNIEISFENASFLDPIKAYLNSLSFPIHGNNTDQITDILSINVTTVCRPAGNEIWCSCETGYGWPRERCLHNLICQERDVFLPGHHCSCLKELPPNGPFCLLQEDVTLNMRVRLNVGFQEDLMNTSSALYRSYKTDLETAFRKGYGILPGFKGVTVTGFKSGSVVVTYEVKTTPPSLELIHKANEQVVQSLNQTYKMDYNSFQAVTINESNFFVTPEIIFEGDTVSLVCEKEVLSSNVSWRYEEQQLEIQNSSRFSIYTALFNNMTSVSKLTIHNITPGDAGEYV

• Full Name: G protein-coupled receptor 116
• Calculated Molecular Weight: 1346 aa, 149 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC066121
• Gene Symbol: GPR116
• Gene ID (NCBI): 221395
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IZF2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GPR116 (ADGRF5, adhesion G protein-coupled receptor F5) is involved in the G protein-coupled receptor signaling pathway and cell surface receptor signaling pathway. may act upstream of or within several processes, including glomerular filtration; pharyngeal arch artery morphogenesis; and surfactant homeostasis.