GPR148 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPR148 Polyclonal antibody, PBS Only (25996-1-PBS)

• 

  IHC staining of mouse testis using 25996-1-AP (same clone as 25996-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25996-1-AP (GPR148 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25996-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 25996-1-AP (same clone as 25996-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25996-1-AP (GPR148 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25996-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 25996-1-AP (same clone as 25996-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 25996-1-AP (GPR148 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25996-1-PBS in a different storage buffer formulation.

GPR148 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 25996-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

BTR, G protein coupled receptor 148, PGR6

---

Product Information

25996-1-PBS targets GPR148 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22948

  Product name: Recombinant human GPR148 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-95 aa of BC105013

  Sequence: MGDELAPCPVGTTAWPALIQLISKTPCMPQAASNTSLGLGDLRVPSSMLYWLFLPSSLLAAATLAVSPLLLVTILRNQRLRQEPHYLLPANILLS

• Full Name: G protein-coupled receptor 148
• Calculated Molecular Weight: 347 aa, 38 kDa
• GenBank Accession Number: BC105013
• Gene Symbol: GPR148
• Gene ID (NCBI): 344561
• RRID: AB_3742164
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TDV2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GPR148, also known as BTR or PGR6, belongs to a G protein-coupled receptor (GPCR) family. It is primarily expressed in the brain and testis, suggesting a role in specific sensory functions and possibly in reproductive processes. As a GPCR, GPR148 is likely to be involved in signal transduction pathways triggered by the binding of specific ligands, such as odorants or other small molecules.