GPR151 Polyclonal antibody

• 

  WB analysis using 30104-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30104-1-AP (GPR151 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

GPR151 Polyclonal Antibody for WB, ELISA

Cat No. 30104-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

G protein coupled receptor 151, GALR4, GALRL, GPCR, GPCR 2037, GPR151, PGR7

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30104-1-AP targets GPR151 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32442

  Product name: Recombinant human GPR151 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 308-419 aa of NM_194251

  Sequence: VMSEEFREGLKGVWKWMITKKPPTVSESQETPAGNSEGLPDKVPSPESPASIPEKEKPSSPSSGKGKTEKAEIPILPDVEQFWHERDTVPSVQDNDPIPWEHEDQETGEGVK

• Full Name: G protein-coupled receptor 151
• Calculated Molecular Weight: 47kd
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: NM_194251
• Gene Symbol: GPR151
• Gene ID (NCBI): 134391
• RRID: AB_3086229
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TDV0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

G protein-coupled receptors (GPCRs) are a superfamily of cell-surface receptors which are important for intracellular signal transduction. GPR151 (G protein-coupled receptor 151) is highly enriched in the the medial and lateral habenula and is expressed at presynaptic membranes and synaptic vesicles (PMID: 32098843). GPR151 has been reported to play an important role in modulating neuropathic pain and controling nicotine addiction vulnerability (PMID: 32098843,34244727,30373770).