Home
Products
Primary Antibodies
GPR3 Polyclonal antibody, PBS Only (20847-1-PBS)

Filter: AllIHC

IHC staining of mouse brain using 20847-1-AP (same clone as 20847-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20847-1-AP (GPR3 antibody) at dilution of 1:50 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20847-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 20847-1-AP (same clone as 20847-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 20847-1-AP (GPR3 antibody) at dilution of 1:50 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20847-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 20847-1-AP (same clone as 20847-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20847-1-AP (GPR3 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20847-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 20847-1-AP (same clone as 20847-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20847-1-AP (GPR3 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20847-1-PBS in a different storage buffer formulation.

GPR3 Polyclonal antibody, PBS Only

Name: GPR3 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 20847-1-PBS

GPR3 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 20847-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

20847-1-PBS targets GPR3 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag14257 Product name: Recombinant human GPR3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 271-330 aa of BC032702 Sequence: DAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV Predict reactive species
Full Name	G protein-coupled receptor 3
Calculated Molecular Weight	330 aa, 35 kDa
GenBank Accession Number	BC032702
Gene Symbol	GPR3
Gene ID (NCBI)	2827
RRID	AB_2878749
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P46089
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

GPR3 (G protein-coupled receptor 3) was first cloned from a mouse cDNA library in 1993 before being cloned from human genomic libraries by several independent groups (PMID: 29941868). GPR3 mRNA is broadly expressed in neurons in various brain regions, including the cortex, thalamus, hypothalamus, amygdala, hippocampus, pituitary, and cerebellum (PMID: 22207171). Moreover, the GPR3 protein is overexpressed in neurons in post-mortem brain tissue sections from individuals afflicted by Alzheimer's disease (PMID: 19213921).