GPR34 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPR34 Polyclonal antibody, PBS Only (22149-1-PBS)

GPR34 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 22149-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

G protein coupled receptor 34, Probable G-protein coupled receptor 34

• 

  WB analysis using 22149-1-AP (same clone as 22149-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22149-1-AP (GPR34 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22149-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 22149-1-AP (same clone as 22149-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22149-1-AP (GPR34 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22149-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

22149-1-PBS targets GPR34 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17742

  Product name: Recombinant human GPR34 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 267-381 aa of BC020678

  Sequence: NSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLHDTSVAVKIQSSSKST

• Full Name: G protein-coupled receptor 34
• Calculated Molecular Weight: 381 aa, 44 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC020678
• Gene Symbol: GPR34
• Gene ID (NCBI): 2857
• RRID: AB_3742067
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPC5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

G protein-coupled receptor 34 (GPR34) is a 7-transmembrane orphan receptor, belonging to the GPCR family, which affects multiple biological and physiological functions, such as cell proliferation and motility, immune infiltration, gene transcription. GPR34 is indeed highly expressed on ILC1-like cells in the tumors of patients with colon adenocarcinoma, head and neck cancer, and liver cancer (PMID: 39358444).