GPR34 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPR34 Polyclonal antibody, PBS Only (22149-1-PBS)

• 

  WB analysis using 22149-1-AP (same clone as 22149-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22149-1-AP (GPR34 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22149-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 22149-1-AP (same clone as 22149-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 22149-1-AP (GPR34 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 22149-1-PBS in a different storage buffer formulation.

GPR34 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 22149-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

G protein coupled receptor 34, Probable G-protein coupled receptor 34

---

Product Information

22149-1-PBS targets GPR34 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17742

  Product name: Recombinant human GPR34 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 267-381 aa of BC020678

  Sequence: NSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCYWKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLHDTSVAVKIQSSSKST

• Full Name: G protein-coupled receptor 34
• Calculated Molecular Weight: 381 aa, 44 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC020678
• Gene Symbol: GPR34
• Gene ID (NCBI): 2857
• RRID: AB_3742067
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UPC5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

G protein-coupled receptor 34 (GPR34) is a 7-transmembrane orphan receptor, belonging to the GPCR family, which affects multiple biological and physiological functions, such as cell proliferation and motility, immune infiltration, gene transcription.