GPR37L1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GPR37L1 Polyclonal antibody (33358-1-AP)

• 

  WB analysis using 33358-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33358-1-AP (GPR37L1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

GPR37L1 Polyclonal Antibody for WB, ELISA

Cat No. 33358-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Endothelin B receptor-like protein 2, ETBRLP2, ETBR-LP-2, G-protein coupled receptor 37-like 1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33358-1-AP targets GPR37L1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36603

  Product name: Recombinant human GPR37L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-134 aa of NM_004767.3

  Sequence: APLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATSPNPGKDGGTPDSGQELRGNLTGAPGQRLQIQNPLYPVTESSYSAYAIM

• Full Name: G protein-coupled receptor 37 like 1
• Calculated Molecular Weight: 53kDa，481aa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_004767.3
• Gene Symbol: GPR37L1
• Gene ID (NCBI): 9283
• RRID: AB_3742948
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O60883
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GPR37L1 (G Protein-Coupled Receptor 37 Like 1) is a protein that belongs to the large and diverse family of G protein-coupled receptors (GPCRs). GPCRs are crucial cellular sensors, spanning the cell membrane to transmit signals from the outside to the inside of the cell, governing virtually every physiological process. The apparent molecular weight is larger than the calculated molecular weight of 53 kDa, which is likely due to posttranslational modification, presumably by glycosylation.