GPR52 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPR52 Polyclonal antibody, PBS Only (30863-1-PBS)

• 

  IHC staining of mouse small intestine using 30863-1-AP (same clone as 30863-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 30863-1-AP (GPR52 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30863-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 30863-1-AP (same clone as 30863-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 30863-1-AP (GPR52 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30863-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 30863-1-AP (same clone as 30863-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using GPR52 antibody (30863-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 30863-1-PBS in a different storage buffer formulation.

GPR52 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 30863-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

G protein coupled receptor 52

---

Product Information

30863-1-PBS targets GPR52 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31188

  Product name: Recombinant human GPR52 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-65 aa of BC067456

  Sequence: MNESRWTEWRILNMSSGIVNVSERHSCPLGFGHYSVVDVCIFETVVIVLLTFLIIAGNLTVIFVF

• Full Name: G protein-coupled receptor 52
• Calculated Molecular Weight: 361 aa, 41 kDa
• GenBank Accession Number: BC067456
• Gene Symbol: GPR52
• Gene ID (NCBI): 9293
• RRID: AB_3669768
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2T5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GPR52, or G protein-coupled receptor 52, is an orphan G protein-coupled receptor (GPCR) that constitutively increases cellular cAMP levels and is coupled to the Gs protein, which activates adenylate cyclase. Agonism of GPR52 has been proposed as a therapeutic intervention for the psychotic and cognitive aspects of schizophrenia. Its role in modulating neurotransmission and the identification of ligands that can interact with it highlight its potential in therapeutic development.