GPR75 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GPR75 Polyclonal antibody, PBS Only (17972-1-PBS)

• 

  IHC staining of mouse brain using 17972-1-AP (same clone as 17972-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17972-1-AP (GPR75 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17972-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17972-1-AP (same clone as 17972-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17972-1-AP (GPR75 Antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 17972-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 17972-1-AP (same clone as 17972-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 17972-1-AP (GPR75 Antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 17972-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 17972-1-AP (same clone as 17972-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using GPR75 antibody (17972-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17972-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 17972-1-AP (same clone as 17972-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using GPR75 antibody (17972-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17972-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 17972-1-AP (same clone as 17972-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using GPR75 antibody (17972-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 17972-1-PBS in a different storage buffer formulation.

GPR75 Polyclonal Antibody for IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 17972-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

Probable G-protein coupled receptor 75

---

Product Information

17972-1-PBS targets GPR75 in IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12053

  Product name: Recombinant human GPR75 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 376-540 aa of BC067475

  Sequence: YSRNSAGLRRKVLWCLQYIGLGFFCCKQKTRLRAMGKGNLEVNRNKSSHHETNSAYMLSPKPQKKFVDQACGPSHSKESMVSPKISAGHQHCGQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPSV

• Full Name: G protein-coupled receptor 75
• Calculated Molecular Weight: 540 aa, 59 kDa
• GenBank Accession Number: BC067475
• Gene Symbol: GPR75
• Gene ID (NCBI): 10936
• RRID: AB_2878475
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95800
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.