GPVI Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• GPVI Recombinant monoclonal antibody (87275-3-RR)

• 

  WB analysis of human peripheral blood platelets using 87275-3-RR

  human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 87275-3-RR (GPVI antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87275-3-RR

  Biolayer interferometry (BLl) kinetic assays of 87275-3-RR against Human GPVI were performed. The affinity constant is 0.174 nM.

GPVI Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87275-3-RR

Clone No.252381D11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

GP6, Glycoprotein 6, glycoprotein VI (platelet), GPIV, Platelet glycoprotein VI

---

Tested Applications

• Positive WB detected in: human peripheral blood platelets

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87275-3-RR targets GPVI in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6474

  Product name: Recombinant human GPVI protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 21-276 aa of NM_016363.5

  Sequence: QSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLG

• Full Name: glycoprotein VI (platelet)
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: NM_016363.5
• Gene Symbol: GP6
• Gene ID (NCBI): 51206
• RRID: AB_3745440
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9HCN6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.