Glutamate receptor 3/GluA3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Glutamate receptor 3/GluA3 Polyclonal antibody, PBS Only (29588-1-PBS)

• 

  WB analysis using 29588-1-AP (same clone as 29588-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29588-1-AP (Glutamate receptor 3/GluA3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29588-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 29588-1-AP (same clone as 29588-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29588-1-AP (GRIA3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29588-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 29588-1-AP (same clone as 29588-1-PBS)

  IP result of anti-GRIA3 (IP:29588-1-AP, 4ug; Detection:29588-1-AP 1:1000) with mouse brain tissue lysate 1280 ug. This data was developed using the same antibody clone with 29588-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 29588-1-AP (same clone as 29588-1-PBS)

  IP result of anti-Glutamate receptor 3/GluA3 (IP:29588-1-AP, 4ug; Detection:29588-1-AP 1:2000) with mouse brain tissue lysate 1280 ug. This data was developed using the same antibody clone with 29588-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 29588-1-AP (same clone as 29588-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using Glutamate receptor 3/GluA3 antibody (29588-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29588-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat brain using 29588-1-AP (same clone as 29588-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using Glutamate receptor 3/GluA3 antibody (29588-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29588-1-PBS in a different storage buffer formulation.

Glutamate receptor 3/GluA3 Polyclonal Antibody for WB, IF-P, IP, Indirect ELISA

Cat No. 29588-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF-P, IP, Indirect ELISA

Synonyms

GRIA3, GLURC, GLUR3, GLUR K3, GLUR C

---

Product Information

29588-1-PBS targets Glutamate receptor 3/GluA3 in WB, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30898

  Product name: Recombinant human GRIA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 288-425 aa of NM_007325

  Sequence: VRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASSENRTI

• Full Name: glutamate receptor, ionotrophic, AMPA 3
• Calculated Molecular Weight: 101 kDa
• Observed Molecular Weight: 101 kDa
• GenBank Accession Number: NM_007325
• Gene Symbol: GRIA3
• Gene ID (NCBI): 2892
• RRID: AB_3086141
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P42263
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. GRIA3 (Glutamate ionotropic receptor AMPA type subunit 3), also known as Glutamate receptor R3 or A3 (GluR3 or GluA3), is associated with X-linked intellectual disability (ID), dysmorphic features, and non-syndromic epilepsy(PMID: 32977175). GRIA3 also plays a role as a mediator of tumor progression in pancreatic cancer downstream CUX1(PMID: 20689760).